All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 03:40, 7 April 2021 Edwardsnj talk contribs created page P01023 (Created page with "{{Protein |accession=P01023 |description=Alpha-2-macroglobulin |gene=A2M |name=A2M |sequence=MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTV SASLESVRGNRSLFTDLEAEN...")