All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

  • 00:14, 7 April 2021 Edwardsnj talk contribs created page P01008 (Created page with "{{Protein |accession=P01008 |description=Antithrombin-III |gene=SERPINC1 |name=SERPINC1 |sequence=MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEK KATEDEGSEQKIPEAT...")