All public logs

Jump to navigation Jump to search

Combined display of all available logs of GPTWiki. You can narrow down the view by selecting a log type, the username (case-sensitive), or the affected page (also case-sensitive).

Logs
  • 17:46, 6 April 2021 Edwardsnj talk contribs created page P00734 (Created page with "{{Protein |accession=P00734 |description=Prothrombin |gene=F2 |name=F2 |sequence=MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC VEETCSYEEAFEALESSTATDVFWAKYTACETA...")