Revision history of "Q9UHG3"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 22:22, 6 April 2021‎ Edwardsnj talk contribs‎ 640 bytes +640‎ Created page with "{{Protein |accession=Q9UHG3 |description=Prenylcysteine oxidase 1 |gene=PCYOX1 |name=PCYOX1 |sequence=MGRVVAELVSSLLGLWLLLCSCGCPEGAELRAPPDKIAIIGAGIGGTSAAYYLRQKFGKD VKIDLFEREEVG..."
Retrieved from "https://gptwiki.glyomics.org/gptwiki/Q9UHG3"