Revision history of "Q9UBV2"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 21:01, 6 April 2021‎ Edwardsnj talk contribs‎ 931 bytes +931‎ Created page with "{{Protein |accession=Q9UBV2 |description=Protein sel-1 homolog 1 |gene=SEL1L |name=SEL1L |sequence=MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF LDSEESELESSIQEE..."
Retrieved from "https://gptwiki.glyomics.org/gptwiki/Q9UBV2"