Revision history of "Q9H3G5"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 17:05, 6 April 2021‎ Edwardsnj talk contribs‎ 619 bytes +619‎ Created page with "{{Protein |accession=Q9H3G5 |description=Probable serine carboxypeptidase CPVL |gene=CPVL |name=CPVL |sequence=MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGREL SLV..."
Retrieved from "https://gptwiki.glyomics.org/gptwiki/Q9H3G5"