From GPTWiki
Revision as of 00:23, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q9BYF1 |description=Angiotensin-converting enzyme 2 |gene=ACE2 |name=ACE2 |sequence=MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ NMNNAGDKW...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Angiotensin-converting enzyme 2
Gene ACE2
Organism Homo sapiens
Species Homo sapiens
GlyGen Q9BYF1

Samples (Peptides)

Human ACE2 Protein (131 / 131)


N53 (19 / 131), N90 (10 / 131), N103 (55 / 131), N322 (5 / 131), N432 (8 / 131), N546 (17 / 131), N690 (17 / 131)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
... further results