Revision history of "Q9BYF1"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 00:23, 7 April 2021Edwardsnj talk contribs 948 bytes +948 Created page with "{{Protein |accession=Q9BYF1 |description=Angiotensin-converting enzyme 2 |gene=ACE2 |name=ACE2 |sequence=MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ NMNNAGDKW..."