Q96PD5

From GPTWiki
Revision as of 18:04, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q96PD5 |description=N-acetylmuramoyl-L-alanine amidase |gene=PGLYRP2 |name=PGLYRP2 |sequence=MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNS...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description N-acetylmuramoyl-L-alanine amidase
Gene PGLYRP2
Organism Homo sapiens
Species Homo sapiens
GlyGen Q96PD5

Samples (Peptides)

Human Serum (6 / 6)

Sites

N77 (1 / 6), N367 (4 / 6), N485 (1 / 6)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00118166R.LYHFLLGAWSLN[H5N4S2]ATELDPCPLSPELLGLTK.E95H5N4S2N775,590.53664
PE001367346R.LEPVHLQLQCMSQEQLAQVAAN[H5N4S]ATK.E370H5N4SN3674,738.09810
PE001472346R.LEPVHLQLQCM[Ox]SQEQLAQVAAN[H5N4S2]ATK.E370H5N4S2N3675,045.18910
PE000236346R.LEPVHLQLQCMSQEQLAQVAAN[H5N4S2]ATKEFTEAFLGCPAIHPR.C385H5N4S2N3676,755.02320
PE000031346R.LEPVHLQLQCMSQEQLAQVAAN[H5N4S2]ATK.E370H5N4S2N3675,029.194127
PE000099477R.GFGVAIVGN[H5N4S2]YTAALPTEAALR.T497H5N4S2N4854,312.89942