Revision history of "Q96PD5"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 18:04, 6 April 2021Edwardsnj talk contribs 724 bytes +724 Created page with "{{Protein |accession=Q96PD5 |description=N-acetylmuramoyl-L-alanine amidase |gene=PGLYRP2 |name=PGLYRP2 |sequence=MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNS..."