Q96IY4

From GPTWiki
Revision as of 19:19, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q96IY4 |description=Carboxypeptidase B2 |gene=CPB2 |name=CPB2 |sequence=MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTAD LIVKKKQVHFFVNASDVDNVK...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Carboxypeptidase B2
Gene CPB2
Organism Homo sapiens
Species Homo sapiens
GlyGen Q96IY4

Samples (Peptides)

Human Serum (1 / 1)

Sites

N73 (1 / 1)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00061666K.KQVHFFVN[H6N5S3]ASDVDNVK.A81H6N5S3N734,724.94810