Revision history of "Q96IY4"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 19:19, 6 April 2021Edwardsnj talk contribs 548 bytes +548 Created page with "{{Protein |accession=Q96IY4 |description=Carboxypeptidase B2 |gene=CPB2 |name=CPB2 |sequence=MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTAD LIVKKKQVHFFVNASDVDNVK..."