Q96HE7

From GPTWiki
Revision as of 08:02, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q96HE7 |description=ERO1-like protein alpha |gene=ERO1A |name=ERO1A |sequence=MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYR LFPRLQKLLESDYFR...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description ERO1-like protein alpha
Gene ERO1A
Organism Homo sapiens
Species Homo sapiens
GlyGen Q96HE7

Samples (Peptides)

HEK293 Cells (2 / 2)

Sites

N280 (2 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE001920277K.WGHN[H6N2]ITEFQQR.F287H6N2N2802,811.16020
PE001921277K.WGHN[H8N2]ITEFQQR.F287H8N2N2803,135.26610