Revision history of "Q96HE7"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 08:02, 7 April 2021Edwardsnj talk contribs 599 bytes +599 Created page with "{{Protein |accession=Q96HE7 |description=ERO1-like protein alpha |gene=ERO1A |name=ERO1A |sequence=MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYR LFPRLQKLLESDYFR..."