Q92626

From GPTWiki
Revision as of 11:26, 8 May 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q92626 |description=Peroxidasin homolog |gene=PXDN |name=PXDN |sequence=MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAV APQTSILDLRFNRIREIQPGA...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Peroxidasin homolog
Gene PXDN
Organism Homo sapiens
Species Homo sapiens
GlyGen Q92626

Samples (Peptides)

HEK293 Cells (3 / 3)

Sites

N1178 (3 / 3)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE0021911,175R.VYCN[H5N2]LSAAHTFEDLK.N1,189H5N2N11783,001.26310
PE0021921,175R.VYCN[H8N2]LSAAHTFEDLK.N1,189H8N2N11783,487.42210
PE0021931,175R.VYCN[H9N2]LSAAHTFEDLK.N1,189H9N2N11783,649.47410