Revision history of "Q92626"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 11:26, 8 May 2021Edwardsnj talk contribs 1,621 bytes +1,621 Created page with "{{Protein |accession=Q92626 |description=Peroxidasin homolog |gene=PXDN |name=PXDN |sequence=MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAV APQTSILDLRFNRIREIQPGA..."