
From GPTWiki
Revision as of 07:34, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q92542 |description=Nicastrin |gene=NCSTN |name=NCSTN |sequence=MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI GCQSSISGDTGVIHVVEKEEDLQWVLTDG...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Nicastrin
Organism Homo sapiens
Species Homo sapiens
GlyGen Q92542

Samples (Peptides)

HEK293 Cells (5 / 5)


N45 (2 / 5), N55 (1 / 5), N530 (2 / 5)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups