Revision history of "Q92542"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 07:34, 7 April 2021Edwardsnj talk contribs 830 bytes +830 Created page with "{{Protein |accession=Q92542 |description=Nicastrin |gene=NCSTN |name=NCSTN |sequence=MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI GCQSSISGDTGVIHVVEKEEDLQWVLTDG..."