
From GPTWiki
Revision as of 07:26, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q8N766 |description=ER membrane protein complex subunit 1 |gene=EMC1 |name=EMC1 |sequence=MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEK NVI...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description ER membrane protein complex subunit 1
Gene EMC1
Organism Homo sapiens
Species Homo sapiens
GlyGen Q8N766

Samples (Peptides)

HEK293 Cells (2 / 2)


N913 (2 / 2)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups