Revision history of "Q8N766"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 07:26, 7 April 2021Edwardsnj talk contribs 1,145 bytes +1,145 Created page with "{{Protein |accession=Q8N766 |description=ER membrane protein complex subunit 1 |gene=EMC1 |name=EMC1 |sequence=MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEK NVI..."