Q7Z4H8

From GPTWiki
Revision as of 03:57, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q7Z4H8 |description=Protein O-glucosyltransferase 3 |gene=POGLUT3 |name=POGLUT3 |sequence=MRRLPRALLLQLRLALLVAAGAPEVLVSAPRSLVWGPGLQAAVVLPVRYFYLQAVNSEGQ NLT...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Protein O-glucosyltransferase 3
Gene POGLUT3
Organism Homo sapiens
Species Homo sapiens
GlyGen Q7Z4H8

Samples (Peptides)

HEK293 Cells (2 / 2)

Sites

N61 (1 / 2), N306 (1 / 2)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00199749R.YFYLQAVNSEGQN[H9N2]LTR.S64H9N2N613,784.57210
PE001958288R.GVTNDLLSIQGNTGPSWIN[H6N2]KTER.A310H6N2N3063,895.75810