Revision history of "Q7Z4H8"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 03:57, 7 April 2021Edwardsnj talk contribs 651 bytes +651 Created page with "{{Protein |accession=Q7Z4H8 |description=Protein O-glucosyltransferase 3 |gene=POGLUT3 |name=POGLUT3 |sequence=MRRLPRALLLQLRLALLVAAGAPEVLVSAPRSLVWGPGLQAAVVLPVRYFYLQAVNSEGQ NLT..."