Q5JTV8

From GPTWiki
Revision as of 17:50, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q5JTV8 |description=Torsin-1A-interacting protein 1 |gene=TOR1AIP1 |name=TOR1AIP1 |sequence=MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFS D...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Torsin-1A-interacting protein 1
Gene TOR1AIP1
Organism Homo sapiens
Species Homo sapiens
GlyGen Q5JTV8

Samples (Peptides)

HEK293 Cells (1 / 1)

Sites

N399 (1 / 1)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE001259397K.HLN[H8N2]SSHPR.S404H8N2N3992,667.06520