Revision history of "Q5JTV8"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 16:50, 6 April 2021Edwardsnj talk contribs 730 bytes +730 Created page with "{{Protein |accession=Q5JTV8 |description=Torsin-1A-interacting protein 1 |gene=TOR1AIP1 |name=TOR1AIP1 |sequence=MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFS D..."