Q14624@N207

From GPTWiki
Revision as of 20:36, 26 May 2021 by Edwardsnj (talk | contribs) (Created page with "{{ProteinSite |aa=N |position=207 |protein=Q14624 }}")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Protein ITIH4 (Q14624)
Site N207
GlyGen Q14624@N207

Samples (Peptides)

Human Serum (1 / 1)

Peptides

 StartPeptideEndGlycanMol. Wt.Trans. GroupsDIA Trans. Groups
PE000358171K.HLQMDIHIFEPQGISFLETESTFMTNQLVDALTTWQN[H5N4]K.T208H5N46,102.75410