
From GPTWiki
Revision as of 04:44, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q14108 |description=Lysosome membrane protein 2 |gene=SCARB2 |name=SCARB2 |sequence=MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPV YTQFYFFNV...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Lysosome membrane protein 2
Organism Homo sapiens
Species Homo sapiens
GlyGen Q14108

Samples (Peptides)

HEK293 Cells (1 / 1)


N412 (1 / 1)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups