Revision history of "Q14108"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 04:44, 7 April 2021Edwardsnj talk contribs 615 bytes +615 Created page with "{{Protein |accession=Q14108 |description=Lysosome membrane protein 2 |gene=SCARB2 |name=SCARB2 |sequence=MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPV YTQFYFFNV..."