Q08380

From GPTWiki
Revision as of 18:33, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q08380 |description=Galectin-3-binding protein |gene=LGALS3BP |name=LGALS3BP |sequence=MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV VCRALG...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Galectin-3-binding protein
Gene LGALS3BP
Organism Homo sapiens
Species Homo sapiens
GlyGen Q08380

Samples (Peptides)

HEK293 Cells (9 / 9)

Sites

N69 (4 / 9), N398 (2 / 9), N551 (3 / 9)

Peptides

 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups
PE00187964R.ALGFEN[H7N6F]ATQALGR.A76H7N6FN693,863.60910
PE00187864R.ALGFEN[H7N6FS2]ATQALGR.A76H7N6FS2N694,445.80020
PE00189864R.ALGFEN[H7N6FS3]ATQALGR.A76H7N6FS3N694,736.89530
PE00218464R.ALGFEN[H7N6FS4]ATQALGR.A76H7N6FS4N695,027.99010
PE002052394R.YKGLN[H5N4FS2]LTEDTYKPR.I407H5N4FS2N3984,065.71910
PE001884396K.GLN[H7N6FS4]LTEDTYKPR.I407H7N6FS4N3985,087.01630
PE001896542K.AAIPSALDTN[H5N4F]SSK.S554H5N4FN5513,060.30110
PE001893542K.AAIPSALDTN[H6N3S]SSK.S554H6N3SN5513,164.31210
PE001897542K.AAIPSALDTN[H6N5FS2]SSK.S554H6N5FS2N5514,007.62510