Revision history of "Q08380"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 18:33, 6 April 2021Edwardsnj talk contribs 727 bytes +727 Created page with "{{Protein |accession=Q08380 |description=Galectin-3-binding protein |gene=LGALS3BP |name=LGALS3BP |sequence=MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV VCRALG..."