
From GPTWiki
Revision as of 05:09, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Protein |accession=Q03591 |description=Complement factor H-related protein 1 |gene=CFHR1 |name=CFHR1 |sequence=MWLLVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFV S...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Description Complement factor H-related protein 1
Gene CFHR1
Organism Homo sapiens
Species Homo sapiens
GlyGen Q03591

Samples (Peptides)

Human Serum (9 / 9)


N126 (1 / 9), N194 (8 / 9)


 StartPeptideEndGlycanSiteMol. Wt.Trans. GroupsDIA Trans. Groups