Revision history of "Q03591"

Jump to navigation Jump to search

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • curprev 05:09, 7 April 2021Edwardsnj talk contribs 473 bytes +473 Created page with "{{Protein |accession=Q03591 |description=Complement factor H-related protein 1 |gene=CFHR1 |name=CFHR1 |sequence=MWLLVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFV S..."