PE002177

From GPTWiki
Revision as of 19:53, 14 May 2021 by Edwardsnj (talk | contribs)
Jump to navigation Jump to search
Name R.QLAHQSN[H5N4F]STNIFFSPVSIATAFAMLSLGTK.A
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4F (N7)
Mod(s)
Molecular Weight 4967.278
Norm. RT
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00637871.38070.3721,238.3254OrbitrapHuman Serum5