PE002177

From GPTWiki
Revision as of 03:59, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G83555HU;N7 |mw=4967.278 |name=R.QLAHQSN{{!(}}H5N4F{{!)}}STNIFFSPVSIATAFAMLSLGTK.A |nox=0 |nrt=158.545 |nrtobs=1 |sequence=QLAHQSNSTNIFFSPVSIATAFAMLSLGTK }}{...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.QLAHQSN[H5N4F]STNIFFSPVSIATAFAMLSLGTK.A
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4F (N7)
Mod(s)
Molecular Weight 4967.278
Norm. RT 158.545
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00637871.38070.3721,238.3254OrbitrapHuman Serum5