Difference between revisions of "PE002177"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G83555HU;N7 |mw=4967.278 |name=R.QLAHQSN{{!(}}H5N4F{{!)}}STNIFFSPVSIATAFAMLSLGTK.A |nox=0 |nrt=158.545 |nrtobs=1 |sequence=QLAHQSNSTNIFFSPVSIATAFAMLSLGTK }}{...")
 
 
(One intermediate revision by the same user not shown)
Line 4: Line 4:
 
|name=R.QLAHQSN{{!(}}H5N4F{{!)}}STNIFFSPVSIATAFAMLSLGTK.A
 
|name=R.QLAHQSN{{!(}}H5N4F{{!)}}STNIFFSPVSIATAFAMLSLGTK.A
 
|nox=0
 
|nox=0
|nrt=158.545
 
|nrtobs=1
 
 
|sequence=QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
 
|sequence=QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
 
}}{{Alignment
 
}}{{Alignment
Line 13: Line 11:
 
|prsites=N70
 
|prsites=N70
 
|raa=A
 
|raa=A
 +
|site=P01009@N70
 
|start=64
 
|start=64
 
}}
 
}}

Latest revision as of 22:09, 26 May 2021

Name R.QLAHQSN[H5N4F]STNIFFSPVSIATAFAMLSLGTK.A
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4F (N7)
Mod(s)
Molecular Weight 4967.278
Norm. RT
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00637871.38070.3721,238.3254OrbitrapHuman Serum5