PE002176

From GPTWiki
Revision as of 18:22, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G49739MP;N4 |mw=5882.592 |name=K.YTGN{{!(}}H7N6F{{!)}}ASALFILPDQDKMEEVEAMLLPETLK.R |nox=0 |sequence=YTGNASALFILPDQDKMEEVEAMLLPETLK }}{{Alignment |end=297 |la...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.YTGN[H7N6F]ASALFILPDQDKMEEVEAMLLPETLK.R
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H7N6F (N4)
Mod(s)
Molecular Weight 5882.592
Norm. RT
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00637762.23663.047139.1601,467.1534OrbitrapHuman Serum14