Difference between revisions of "PE002176"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G49739MP;N4 |mw=5882.592 |name=K.YTGN{{!(}}H7N6F{{!)}}ASALFILPDQDKMEEVEAMLLPETLK.R |nox=0 |sequence=YTGNASALFILPDQDKMEEVEAMLLPETLK }}{{Alignment |end=297 |la...")
 
 
Line 11: Line 11:
 
|prsites=N271
 
|prsites=N271
 
|raa=R
 
|raa=R
 +
|site=P01011@N271
 
|start=268
 
|start=268
 
}}
 
}}

Latest revision as of 22:09, 26 May 2021

Name K.YTGN[H7N6F]ASALFILPDQDKMEEVEAMLLPETLK.R
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H7N6F (N4)
Mod(s)
Molecular Weight 5882.592
Norm. RT
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00637762.23663.047139.1601,467.1534OrbitrapHuman Serum14