PE001858

From GPTWiki
Revision as of 08:01, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G95865ZB;N6 |mod=+57.021;C20 |mw=5107.271 |name=K.SLGNVN{{!(}}H4N3S{{!)}}FTVSAEALESQELCGTEVPSVPEHGRK.D |nox=0 |nrt=74.687 |nrtobs=1 |sequence=SLGNVNFTVSAEALE...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.SLGNVN[H4N3S]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H4N3S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5107.271
Norm. RT 74.687
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00526160.05460.10474.6871,273.3264OrbitrapHuman Serum8