Difference between revisions of "PE001858"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G95865ZB;N6 |mod=+57.021;C20 |mw=5107.271 |name=K.SLGNVN{{!(}}H4N3S{{!)}}FTVSAEALESQELCGTEVPSVPEHGRK.D |nox=0 |nrt=74.687 |nrtobs=1 |sequence=SLGNVNFTVSAEALE...")
 
 
Line 14: Line 14:
 
|prsites=N869
 
|prsites=N869
 
|raa=D
 
|raa=D
 +
|site=P01023@N869
 
|start=864
 
|start=864
 
}}
 
}}

Latest revision as of 21:53, 26 May 2021

Name K.SLGNVN[H4N3S]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H4N3S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5107.271
Norm. RT 74.687
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00526160.05460.10474.6871,273.3264OrbitrapHuman Serum8