PE001836

From GPTWiki
Revision as of 20:52, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I
Sequence SPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVR
Glycans(s) H5N4S2 (N32)
Mod(s) 57.021 (C7), 57.021 (C23)
Molecular Weight 7020.188
Norm. RT 172.115
Protein F2 (P00734)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00510579.73980.019172.1151,401.4485OrbitrapHuman Serum15