
From GPTWiki
Revision as of 01:37, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G00912UN;N32 |mod=+57.021;C7,+57.021;C23 |mw=7020.188 |name=K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN{{!(}}H5N4S2{{!)}}FTENDLLVR.I |nox=0 |nrt=172.115 |nrtobs=1 |se...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Glycans(s) H5N4S2 (N32)
Mod(s) 57.021 (C7), 57.021 (C23)
Molecular Weight 7020.188
Norm. RT 172.115
Protein F2 (P00734)


Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00510579.73980.019172.1151,401.4485OrbitrapHuman Serum15