Difference between revisions of "PE001836"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G00912UN;N32 |mod=+57.021;C7,+57.021;C23 |mw=7020.188 |name=K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN{{!(}}H5N4S2{{!)}}FTENDLLVR.I |nox=0 |nrt=172.115 |nrtobs=1 |se...")
 
 
Line 14: Line 14:
 
|prsites=N416
 
|prsites=N416
 
|raa=I
 
|raa=I
 +
|site=P00734@N416
 
|start=385
 
|start=385
 
}}
 
}}

Latest revision as of 21:52, 26 May 2021

Name K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I
Sequence SPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVR
Glycans(s) H5N4S2 (N32)
Mod(s) 57.021 (C7), 57.021 (C23)
Molecular Weight 7020.188
Norm. RT 172.115
Protein F2 (P00734)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00510579.73980.019172.1151,401.4485OrbitrapHuman Serum15