PE001774

From GPTWiki
Revision as of 15:09, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G83555HU;N28 |mod=+57.021;C12,+57.021;C24 |mw=5820.555 |name=R.TLYQFQFQEALCQAAKHEGPLHKCDISN{{!(}}H5N4F{{!)}}STEAGQK.L |nox=0 |sequence=TLYQFQFQEALCQAAKHEGPLH...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H5N4F]STEAGQK.L
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H5N4F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5820.555
Norm. RT
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00467834.94838.21861.207968.1036OrbitrapHuman ACE2 Protein12