PE001771

From GPTWiki
Revision as of 20:49, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H4N3F]STEAGQK.L
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H4N3F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5455.423
Norm. RT 53.682
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00475235.38335.25353.682907.2476OrbitrapHuman ACE2 Protein20