View source for PE001766

Jump to navigation Jump to search

You do not have permission to edit this page, for the following reason:

The action you have requested is limited to users in the group: Users.

You can view and copy the source of this page.

{{Peptide
|glycan=G72787SB;N27
|mw=7122.135
|name=K.TFLDKFNHEAEDLFYQSSLASWNYNTN{{!(}}H4N4{{!)}}ITEENVQNMNNAGDKWSAFLK.E
|nox=0
|nrt=143.751
|nrtobs=2
|sequence=TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
}}{{Alignment
|end=74
|laa=K
|protein=Q9BYF1
|prsites=N53
|raa=E
|site=Q9BYF1@N53
|start=27
}}

Templates used on this page:

Return to PE001766.

Retrieved from "https://gptwiki.glyomics.org/gptwiki/PE001766"