PE001765

From GPTWiki
Revision as of 21:48, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N5F]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N5F (N27)
Mod(s)
Molecular Weight 7471.272
Norm. RT 145.050
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00466071.25871.255145.0501,491.6605OrbitrapHuman ACE2 Protein8