PE001760

From GPTWiki
Revision as of 21:14, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G45504EY;N27 |mw=7413.230 |name=K.TFLDKFNHEAEDLFYQSSLASWNYNTN{{!(}}H4N4S{{!)}}ITEENVQNMNNAGDKWSAFLK.E |nox=0 |nrt=153.725 |nrtobs=2 |sequence=TFLDKFNHEAEDLFY...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4S]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4S (N27)
Mod(s)
Molecular Weight 7413.230
Norm. RT 153.725
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00480574.97774.930153.2231,480.0525OrbitrapHuman ACE2 Protein12
TG00463675.00374.871154.2271,480.0525OrbitrapHuman ACE2 Protein8