PE001758

From GPTWiki
Revision as of 23:36, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G35029YA;N27 |mw=6960.082 |name=K.TFLDKFNHEAEDLFYQSSLASWNYNTN{{!(}}H3N4{{!)}}ITEENVQNMNNAGDKWSAFLK.E |nox=0 |nrt=143.810 |nrtobs=1 |sequence=TFLDKFNHEAEDLFYQ...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N4 (N27)
Mod(s)
Molecular Weight 6960.082
Norm. RT 143.810
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00482171.39771.182143.8101,389.4225OrbitrapHuman ACE2 Protein6