Difference between revisions of "PE001758"

From GPTWiki
Jump to navigation Jump to search
 
(One intermediate revision by the same user not shown)
Line 4: Line 4:
 
|name=K.TFLDKFNHEAEDLFYQSSLASWNYNTN{{!(}}H3N4{{!)}}ITEENVQNMNNAGDKWSAFLK.E
 
|name=K.TFLDKFNHEAEDLFYQSSLASWNYNTN{{!(}}H3N4{{!)}}ITEENVQNMNNAGDKWSAFLK.E
 
|nox=0
 
|nox=0
|nrt=144.415
+
|nrt=143.810
|nrtobs=3
+
|nrtobs=1
 
|sequence=TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
 
|sequence=TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
 
}}{{Alignment
 
}}{{Alignment
Line 13: Line 13:
 
|prsites=N53
 
|prsites=N53
 
|raa=E
 
|raa=E
 +
|site=Q9BYF1@N53
 
|start=27
 
|start=27
 
}}
 
}}

Latest revision as of 21:48, 26 May 2021

Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N4 (N27)
Mod(s)
Molecular Weight 6960.082
Norm. RT 143.810
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00482171.39771.182143.8101,389.4225OrbitrapHuman ACE2 Protein6