Difference between revisions of "PE001754"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G08293MJ;N27 |mw=7721.341 |name=K.TFLDKFNHEAEDLFYQSSLASWNYNTN{{!(}}H5N4FS{{!)}}ITEENVQNMNNAGDKWSAFLK.E |nox=0 |nrt=154.283 |nrtobs=4 |sequence=TFLDKFNHEAEDLF...")
 
 
Line 13: Line 13:
 
|prsites=N53
 
|prsites=N53
 
|raa=E
 
|raa=E
 +
|site=Q9BYF1@N53
 
|start=27
 
|start=27
 
}}
 
}}

Latest revision as of 21:48, 26 May 2021

Name K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4FS]ITEENVQNMNNAGDKWSAFLK.E
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4FS (N27)
Mod(s)
Molecular Weight 7721.341
Norm. RT 154.283
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00468375.08775.184155.0211,541.6745OrbitrapHuman ACE2 Protein8
TG00480375.14975.064153.5601,284.8966OrbitrapHuman ACE2 Protein8
TG00469275.08775.178155.0061,284.8966OrbitrapHuman ACE2 Protein9
TG00478875.14975.032153.4791,541.6745OrbitrapHuman ACE2 Protein10