PE001684

From GPTWiki
Revision as of 15:59, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G44953PJ;N16 |mw=6106.726 |name=R.IFKEAEKFFVSVGLPN{{!(}}H4N5FS{{!)}}MTQGFWENSMLTDPGNVQK.A |nox=0 |nrt=143.182 |nrtobs=1 |sequence=IFKEAEKFFVSVGLPNMTQGFWENSML...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.IFKEAEKFFVSVGLPN[H4N5FS]MTQGFWENSMLTDPGNVQK.A
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H4N5FS (N16)
Mod(s)
Molecular Weight 6106.726
Norm. RT 143.182
Protein ACE2 (Q9BYF1)

Samples

Human ACE2 Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00471670.33570.519143.1821,523.1874OrbitrapHuman ACE2 Protein8